human blood

By Targets:	Adenosine Receptor (4) AMPK (1) Angiotensin Receptor (3) Apoptosis (15) Autophagy (10) Bacterial (3) Beta-secretase (2) Biochemical Assay Reagents (4) Cannabinoid Receptor (1) CCR (1) CD38 (1) CGRP Receptor (1) Chloride Channel (1) Cholinesterase (ChE) (2) Complement System (3) COX (13) CXCR (3) Dopamine Receptor (2) Dopamine Transporter (1) Dopamine β-hydroxylase (2) Drug Metabolite (4) EGFR (1) Endogenous Metabolite (5) Endothelin Receptor (4) Epigenetic Reader Domain (2) Epoxide Hydrolase (1) ERK (1) FAAH (1) Ferroptosis (2) FLAP (6) Fluorescent Dye (3) Formyl Peptide Receptor (FPR) (1) Glucocorticoid Receptor (1) GPR139 (1) HDAC (3) Histamine Receptor (3) HIV (5) HMG-CoA Reductase (HMGCR) (7) IFNAR (3) Interleukin Related (5) IRAK (1) Isotope-Labeled Compounds (4) JAK (3) Leukotriene Receptor (6) Lipase (1) Lipoxygenase (4) mAChR (2) MAGL (1) MAP3K (2) MAP4K (1) mGluR (2) Microtubule/Tubulin (1) Mineralocorticoid Receptor (2) Mitochondrial Metabolism (1) Monoamine Oxidase (5) Neurokinin Receptor (1) Neuropeptide Y Receptor (3) NF-κB (2) NO Synthase (1) Nuclear Hormone Receptor 4A/NR4A (1) Nucleoside Antimetabolite/Analog (2) Opioid Receptor (2) Orexin Receptor (OX Receptor) (3) Oxytocin Receptor (1) P2X Receptor (1) p38 MAPK (1) Parasite (4) PGE synthase (1) Phosphodiesterase (PDE) (3) Potassium Channel (2) PPAR (2) Prostaglandin Receptor (4) Reactive Oxygen Species (1) Renin (1) ROR (1) Ser/Thr Protease (1) TNF Receptor (2) Toll-like Receptor (TLR) (5) Topoisomerase (1) Transferrin Receptor (1) γ-secretase (1)
By Research Areas:	Cancer (41) Cardiovascular Disease (23) Endocrinology (12) Infection (16) Inflammation/Immunology (73) Metabolic Disease (19) Neurological Disease (36)
Click Chemistry:	Azide (1)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-118870

γ-Globulins from human blood	Endogenous Metabolite	Inflammation/Immunology
γ-Globulins from human blood are a class of proteins in the blood. γ-Globulin is a protein fraction of blood serum containing many antibodies that protect against bacterial and viral infectious diseases. γ-Globulins from human blood is used for common variable immunodeficiency

HY-137892

GSK620	Epigenetic Reader Domain	Inflammation/Immunology
GSK620 is a potent and orally active pan-BD2 inhibitor with excellent broad selectivity, developability and in vivo oral pharmacokinetics. GSK620 is highly selective for the BET-BD2 family of proteins, with >200-fold selectivity over all other bromodomains. GSK620 shows an anti-inflammatory phenotype in human whole blood .

HY-153440

JAK-IN-25	JAK	Cancer
JAK-IN-25 (compound 19) is a potent JAK inhibitor with IC₅₀s of 6 nM, 21 nM, 8 nM, 1051 nM for TYK2, JAK1, JAK2, JAK3, respectively. JAK-IN-25 inhibits human whole blood IL-12 (HEB IL-12) with an IC₅₀ of 28 nM. JAK-IN-25 has the potential for cancer research .

HY-125859A

*Myeloperoxidase, human* white blood cells** MPO	Bacterial	Inflammation/Immunology
Myeloperoxidase, human white blood cells (MPO) is a peroxidase. In Myeloperoxidase, human white blood cells mediate oxidative stress by promoting the production of reactive oxygen species (ROS) and active nitrogen (RNS), regulating the polarization and inflammation-related signaling pathways of microglia and neutrophils. Myeloperoxidase, human white blood cells has antibacterial activity .

HY-W011297

Methyl arachidonate Arachidonic acid methyl ester	Others	Metabolic Disease
Methyl arachidonate (Arachidonic acid methyl ester) is a fatty acid methyl ester resulting from the formal condensation of the carboxy group of arachidonic acid with methanol. Methyl arachidonate has activity of human blood serum metabolite .

HY-16276

Osilodrostat 3 Publications Verification LCI699	Mineralocorticoid Receptor	Inflammation/Immunology Cancer
Osilodrostat (LCI699) is a potent, orally active11β-hydroxylase (CYP11B1) inhibitor with an IC₅₀ value of 35 nM. Osilodrostat is a potent, orally aldosterone synthase (CYP11B2) inhibitor with IC₅₀ values of 0.7 nM and 160 nM for human aldosterone synthase and rat aldosterone synthase, respectively. Osilodrostat inhibits aldosterone and corticosterone synthesis. Osilodrostat has blood pressure lowering ability. Osilodrostat can be used for research of Cushing syndrome (CS) .

HY-16276A

Osilodrostat phosphate 3 Publications Verification LCI699 phosphate	Mineralocorticoid Receptor	Cancer
Osilodrostat (LCI699) phosphate is a potent, orally active11β-hydroxylase (CYP11B1) inhibitor with an IC₅₀ value of 35 nM. Osilodrostat phosphate is a potent, orally aldosterone synthase (CYP11B2) inhibitor with IC₅₀ values of 0.7 nM and 160 nM for human aldosterone synthase and rat aldosterone synthase, respectively. Osilodrostat phosphate inhibits aldosterone and corticosterone synthesis. Osilodrostat phosphate has blood pressure lowering ability. Osilodrostat phosphate can be used for research of Cushing syndrome (CS) .

HY-113098

2-Oxovaleric acid

Endogenous Metabolite Metabolic Disease

2-Oxovaleric acid is a keto acid that is found in human blood.
HY-105207

L 696229

HIV Infection

L 696229 is a specific inhibitor ofhuman immunodeficiency virus type 1 (HIV-1)reverse transcriptase (RT) activity that possesses antiviral activity .

2-Oxovaleric acid	Endogenous Metabolite	Metabolic Disease
2-Oxovaleric acid is a keto acid that is found in human blood.

L 696229	HIV	Infection
L 696229 is a specific inhibitor ofhuman immunodeficiency virus type 1 (HIV-1)reverse transcriptase (RT) activity that possesses antiviral activity .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-133608

4,6-Dichloroguaiacol

Others Inflammation/Immunology

4,6-Dichloroguaiacol induces biochemical and morphological changes in human peripheral blood lymphocytes in vitro .

4,6-Dichloroguaiacol	Others	Inflammation/Immunology
4,6-Dichloroguaiacol induces biochemical and morphological changes in human peripheral blood lymphocytes in vitro .

HY-139414

Lysophosphatidylcholines 1 Publications Verification	Interleukin Related p38 MAPK ERK Apoptosis	Inflammation/Immunology
Lysophosphatidylcholines is an orally active lysolipid and a component of oxidized low density lipoprotein (LDL). Lysophosphatidylcholines induces cell injury, the production of IL-1β and apoptosis. Lysophosphatidylcholines has a proactive effect on sepsis .

HY-18725A

P2X7-IN-2 TFA	P2X Receptor Interleukin Related	Cardiovascular Disease Inflammation/Immunology
P2X7-IN-2 TFA (compound 58) is a P2X7 receptor inhibitor. P2X7-IN-2 TFA inhibits IL-Iβ release with an IC₅₀ value of 0.01 nM. P2X7-IN-2 TFA can be used for the research of autoimmunity, inflammation and cardiovascular disease .

HY-13344

PF-8380 5 Publications Verification	Phosphodiesterase (PDE)	Inflammation/Immunology Cancer
PF-8380 is a potent autotaxin inhibitor with an IC₅₀ of 2.8 nM in isolated enzyme assay and 101 nM in human whole blood.

HY-13344A

PF-8380 hydrochloride 5 Publications Verification	Phosphodiesterase (PDE)	Inflammation/Immunology Cancer
PF-8380 hydrochloride is a potent autotaxin inhibitor with an IC₅₀ of 2.8 nM in isolated enzyme assay and 101 nM in human whole blood.

HY-100244

NS1652

Chloride Channel Neurological Disease

NS1652 is a reversible anion conductance inhibitor, blocks chloride channel, with an IC₅₀ of 1.6 μM in human and mouse red blood cells.

NS1652	Chloride Channel	Neurological Disease
NS1652 is a reversible anion conductance inhibitor, blocks chloride channel, with an IC₅₀ of 1.6 μM in human and mouse red blood cells.

HY-A0168

Regadenoson 1 Publications Verification CVT-3146	Adenosine Receptor	Cardiovascular Disease
Regadenoson (CVT-3146) is a selective A2A adenosine receptor agonist and vasodilator that increases coronary blood flow, can be used in study of myocardial perfusion imaging. Regadenoson also increases the permeability of the blood-brain barrier (BBB) in rodents, can be used to study increased delivery of agents to the human CNS .

HY-151894

I-BET432	Epigenetic Reader Domain	Cancer
I-BET432 is a BET inhibitor. I-BET432 inhibits BRD4 N-terminal bromodomain (BD1) and the C-terminal bromodomain (BD2) with pIC₅₀ values of 7.5 and 7.2, respectively. I-BET432 can be used as an oral candidate quality molecule for the research of multiple oncology and inflammatory diseases .

HY-155357

Antibacterial agent 160	Bacterial	Infection
Antibacterial agent 160 is a potent antibacterial agents. Antibacterial agent 160 can rapidly kill bacterial and inhibits bacterial biofilm formation. Antibacterial agent 160 affects the normal function of DNA and leads cell death .

HY-P5792

Atrial natriuretic peptide (3-28) (human) ANP (3-28) (human)	Endothelin Receptor	Metabolic Disease
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .

HY-107275

Ebeiedinone	Cholinesterase (ChE)	Neurological Disease
Ebeiedinone, a steroidal alkaloid from Fritillaria species, inhibits the bioactivity of human whole blood cholinesterase (ChE) at the concentration of 0.1 mM, with the inhibitory effects of 69.0% .

HY-N11691

Thapsigargicin Thapsigargicine	Others	Inflammation/Immunology
Thapsigargicin (Thapsigargicine) is a activator of mast cells and leukocytes. Thapsigargicin induces histamine release from rat peritoneal mast cells and human basophil leukocytes. Thapsigargicin increases the cytoplasmic free calcium level in intact human blood platelets .

HY-U00170

Bunaprolast U66858	Leukotriene Receptor Prostaglandin Receptor Lipoxygenase	Inflammation/Immunology Endocrinology
Bunaprolast (U66858) is a potent inhibitor of LTB₄ production in human whole blood. Bunaprolast (U66858) also exhibits significant inhibition of lipoxygenase and TXB₂ release.

HY-P2273

Calcitonin (human)	CGRP Receptor	Metabolic Disease
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .

HY-15321S2

Etoricoxib-d3 MK-0663-d₃; L-791456-d₃	COX
Etoricoxib-d₃ is the deuterium labeled Etoricoxib[1]. Etoricoxib (MK-0663) is a non steroidal anti-inflammatory agent, acting as a selective and orally active COX-2 inhibitor, with IC50s of 1.1 μM and 116 μM for COX-2 and COX-1 in human whole blood[2][3][4].

HY-107781

PAT-505	Phosphodiesterase (PDE)	Inflammation/Immunology
PAT-505 is a potent, selective, noncompetitive and orally available autotaxin inhibitor, with an IC₅₀ of 2 nM in Hep3B cells, 9.7 nM in human blood and 62 nM in mouse plasma.

HY-W050031

(S)-3-Hydroxybutanoic acid 1 Publications Verification (S)-β-Hydroxybutanoic acid; L-(+)-3-Hydroxybutyric acid; L-β-Hydroxybutyric acid	Endogenous Metabolite	Others
(S)-3-Hydroxybutanoic acid is a normal human metabolite, that has been found elevated in geriatric patients remitting from depression. In humans, 3-Hydroxybutyric acid is synthesized in the liver from acetyl-CoA, and can be used as an energy source by the brain when blood glucose is low.

HY-106093

Eltenac	COX	Inflammation/Immunology
Eltenac, a non-steroidal anti-inflammatory drug (NSAID), is a COX inhibitor. Eltenac shows IC50 of 0.03 μM for both COX-1 and COX-2 in isolated human whole blood .

HY-116638

AHR-5333	Lipoxygenase	Endocrinology
AHR-5333 is a selective human blood neutrophil 5-lipoxygenase inhibitor. AHR-5333 exhibits potent, long-acting activity in rat and guinea pig in vivo models of immediate hypersensitivity .

HY-161307

T-518	HDAC	Neurological Disease
T-518 is an orally active, selective, and blood-brain barrier permeable HDAC6 inhibitor with an IC₅₀ value of 36 nM for human HDAC6. T-581 can be used in research on tauopathy .

HY-146059

Antibacterial agent 99	Bacterial	Infection
Antibacterial agent 99 (compound 7b) is a potent antibacterial agent. Antibacterial agent 99 shows significant antibacterial and antifungal activity. Antibacterial agent 99 dose not show haemolytic activity .

HY-150744

ODN 24888	Toll-like Receptor (TLR)	Inflammation/Immunology
ODN 24888 is an guanine-modified inhibitory oligonucleotides (INH-ODN), shows potent inhibition on TLR7/TLR9-mediated signaling. ODN 24888 impairs IFN-α level and NF-κB activation, inhibits IL-6 release. ODN 24888 involves in immune and inflammatory responses, can be used as a vaccine adjuvant .

HY-15874

Fiboflapon GSK2190915; AM-803	FLAP Leukotriene Receptor	Inflammation/Immunology
Fiboflapon (GSK2190915; AM-803) is a potent and orally bioavailable 5-lipoxygenase-activating protein (FLAP) inhibitor with a potency of 2.9 nM in FLAP binding, an IC₅₀ of 76 nM for inhibition of LTB4 in human blood .

HY-15874A

Fiboflapon sodium GSK2190915 sodium salt; AM-803 sodium	FLAP Leukotriene Receptor	Inflammation/Immunology
Fiboflapon sodium (GSK2190915; AM-803) is a potent and orally bioavailable 5-lipoxygenase-activating protein (FLAP) inhibitor with a potency of 2.9 nM in FLAP binding, an IC₅₀ of 76 nM for inhibition of LTB4 in human blood .

HY-113854

AZD2906	Glucocorticoid Receptor	Cardiovascular Disease Endocrinology
AZD2906 is a selective glucocorticoid receptor (GR) agonist, increases micronucleated immature erythrocytes in the bone marrow of rats. AZD2906 shows IC₅₀s of 2.2, 0.3, 41.6 and 7.5 nM at GR in human, rat PBMC and human, rat whole blood, respectively .

HY-125301

Thymoctonan	Others	Inflammation/Immunology
Thymoctonan (THF-γ2) is the immunomodulatory octapeptide, thymic humoral factor γ2. Thymoctonan has the half-life less than 6 min at 37 °C in blood from human, rat and mouse .

HY-153240

ACT-672125	CXCR	Inflammation/Immunology
ACT-672125 is a potent CXCR3 antagonist with IC₅₀ value of 239 nM in human blood. ACT-672125 has activity for hERG with IC₅₀ value of 18μM. ACT-672125 can be used for the research of autoimmune diseases .

HY-B0589

Atorvastatin 25+ Cited Publications	HMG-CoA Reductase (HMGCR) Autophagy	Metabolic Disease Inflammation/Immunology
Atorvastatin is an orally active HMG-CoA reductase inhibitor, has the ability to effectively decrease blood lipids. Atorvastatin inhibits human SV-SMC proliferation and invasion with IC₅₀s of 0.39 μM and 2.39 μM, respectively .

HY-P2491

Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled	Fluorescent Dye	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .

HY-118941

BAY 73-1449	Prostaglandin Receptor	Cardiovascular Disease
BAY 73-1449 is a selective antagonist of prostacyclin receptor (IP), with high potency (IC₅₀ of less than 0.1 nM) in cAMP assays in Human HEL cells and rat DRG. BAY 73-1449 can be used in the research of lowering blood pressure .

HY-A0184

Remikiren Ro 42-5892; Ro 42-5892/001	Renin	Cardiovascular Disease
Remikiren (Ro 42-5892) is an orally active and highly specific renin inhibitor. Remikiren specifically inhibits human reninand human plasma renin with IC₅₀ values of 0.7 and 0.8 nM, respectively. Remikiren also reduces mean arterial blood pressure in sodium-depleted marmosets and squirrel monkeys. Remikiren can be used in study of hypertension .

HY-10797

CJ-42794 1 Publications Verification CJ-042794	Prostaglandin Receptor	Inflammation/Immunology Endocrinology
CJ-42794 (CJ-042794) is a potent, orally active, selective prostaglandin E receptor 4 (EP4) antagonist with an IC₅₀ value of 10 nM, which is 200-fold more selective than EP1, EP2 and EP3. CJ-42794 can be used in research of gastric ulcers .

HY-P99371

Lirentelimab AK002; Anti-Siglec-8 Reference Antibody (lirentelimab)	Apoptosis	Inflammation/Immunology
Lirentelimab (AK002) is a humanized IgG1 monoclonal antibody that targets sialic acid-binding Ig-like lectin 8 (SIGLEC8). Lirentelimab induces cell apoptosis of IL-5-activated eosinophils and inhibits IgE-mediated mast cell activation. Lirentelimab can be used for the research of eosinophilic gastritis and duodenitis .

HY-146286

Anticancer agent 44	Apoptosis	Cancer
Anticancer agent 44 (compound 2a) is a potent anticancer agent. Anticancer agent 44 shows cytotoxicity activity in cancer cells. Anticancer agent 44 induces apoptosis. Anticancer agent 44 shows low toxicity towards activated lymphocytes of human blood .

HY-121996

Prostaglandin E2 Ethanolamide PGE2 ethanolamide	Prostaglandin Receptor COX	Inflammation/Immunology
Prostaglandin E2 Ethanolamide (PGE₂-EA), an analog of PGE2, can be formed enzymatically following COX-2 oxygenation of endocannabinoids. Prostaglandin E2 Ethanolamide (PGE₂-EA) could modulate the production of the proinflammatory cytokine TNF-α in human blood and human monocytic cells .

HY-32015

Cot inhibitor-1 2 Publications Verification	MAP3K	Inflammation/Immunology
Cot inhibitor-1 (compound 28) is a selective tumor progression loci-2 (Tpl2) kinase inhibitor with an IC₅₀ of 28 nM. Cot inhibitor-1 shows an inhibition of TNF-alpha production in human whole blood with an IC₅₀ of 5.7 nM .

HY-15321

Etoricoxib MK-0663; L-791456	COX	Inflammation/Immunology Cancer
Etoricoxib (MK-0663) is a non steroidal anti-inflammatory agent, acting as a selective and orally active COX-2 inhibitor, with IC₅₀s of 1.1 μM and 116 μM for COX-2 and COX-1 in human whole blood.

HY-108257

Atorvastatin sodium	HMG-CoA Reductase (HMGCR) Autophagy	Metabolic Disease Inflammation/Immunology
Atorvastatin sodium is an orally active HMG-CoA reductase inhibitor, has the ability to effectively decrease blood lipids. Atorvastatin sodium inhibits human SV-SMC proliferation and invasion with IC₅₀s of 0.39 μM and 2.39 μM, respectively .

HY-16693

LDN-27219 1 Publications Verification	Others	Others
LDN-27219 is a reversible, slow-binding inhibitor of TGase. LDN-27219 inhibits human TGase with an IC₅₀ value of 0.6 μM. LDN-27219 effectively decreases blood pressure and induces vasodilation, it can be used for the research of cardiovascular disease .

HY-19837

BMS-986120
BMS-986120 is a first-in-class oral and reversible protease-activated receptor 4 (PAR4) antagonist, with IC₅₀s of 9.5 nM and 2.1 nM in human and monkey blood, respectively. BMS-986120 has potent and selective antiplatelet effects .

Cat. No.	Product Name

HY-L114

Anti-inflammatory Traditional Chinese Medicine Active Compound Library

1060 compounds

Inflammation promotes physiological and pathological processes by the activation of the immune system, local vascular system, and various cells within the damaged tissue. Accumulating epidemiological and clinical evidence shows that chronic inflammation is causally linked to various human diseases, including cerebrovascular, cardiovascular, joint, cutaneous, pulmonary, blood, liver, and intestinal diseases as well as diabetes.

Various natural products from Traditional Chinese Medicine (TCM) have been shown to safely suppress proinflammatory pathways and control inflammation-associated disease. MCE designs a unique collection of 1060 Traditional Chinese Medicine active compounds with anti-inflammatory activity, which are derived from Coptis chinensis, Radix isatidis, Flos Lonicerae, Forsythia suspensa, etc. MCE Anti-inflammatory Traditional Chinese Medicine Active Compound Library is a useful tool for discovery anti-inflammatory drugs from TCM.

HY-L045

Oxygen Sensing Compound Library

2507 compounds

Oxygen homeostasis regulation is the most fundamental cellular process for adjusting physiological oxygen variations, and its irregularity leads to various human diseases, including cancer. Hypoxia is closely associated with cancer development, and hypoxia/oxygen-sensing signaling plays critical roles in the modulation of cancer progression.

Hypoxia-inducible factor 1 (HIF-1) is a transcription factor that functions as a master regulator of oxygen homeostasis. A variety of HF-1 target genes have been identified thus far which encode proteins that play key roles in critical developmental and physiological processes including angiogenesis/vascular remodeling, erythropoiesis, glucose transport, glycolysis, iron transport, and cell proliferation/survival.

HIF-1 is a heterodimeric transcription factor consisting of a constitutively expressed β-subunit and an oxygen-regulated α-subunit. The unique feature of HIF-1 is the regulation of HIF-1α expression and activity based upon the cellular O₂ concentration. Under normoxic conditions, hydroxylation of HIF-1α on these different proline residues is essential for HIF proteolytic degradation by promoting interaction with the von Hippel-Lindau tumor-suppressor protein (pVHL) through hydrogen bonding to the hydroxyproline-binding pocket in the pVHL β-domain. As oxygen levels decrease, hydroxylation of HIF decreases; HIF-1α then no longer binds pVHL, and becomes stabilized, allowing more of the protein to translocate to the cell’s nucleus, where it acts as a transcription factor, upregulating (often within minutes) the production of proteins that stimulate blood perfusion in tissues and thus tissue oxygenation.

MCE offers a unique collection of 2507 oxygen sensing related compounds targeting HIF/HIF Prolyl-Hydroxylase, MAPK/ERK, PI3K/AKT signaling pathways, etc. MCE Oxygen Sensing Compound Library is a useful tool to study hypoxia, oxidative stress and discover new anti-cancer drugs.

Cat. No.	Product Name	Type

HY-D0004

Azure B Azure B chloride	Dyes
Azure B is a cationic dye and the major metabolite of Methylene blue. Azure B is used in making Azure eosin stains for blood smear staining. Azure B is a high-potency, selective and reversible inhibitor of monoamine oxidases (MAO)-A, with IC₅₀s of 11 and 968 nM for recombinant human MAO-A and MAO-B, respectively. Azure B possesses significant antidepressant-like effects .

HY-101898

Indo-1 AM

Indo-1 Acetoxymethyl ester

Fluorescent Dyes/Probes

Calcium is an important part of the human body, usually in the form of calcium, a large number of bones and teeth of the human body, a small amount of blood and tissues. MCE calcium ion detection probe can specifically identify intracellular calcium ions, with high sensitivity, low cytotoxicity, increased AM acetylmethyl ester can enter the cell well, after being sheared by the intracellular esterase stay in the cell to bind to calcium ions, produce strong fluorescence, in addition, Mag-indo-1/AM and Mag-Fluo-4 AM at a certain concentration (usually 5 mM) can effectively identify intracellular magnesium ions .

HY-D1701

Mag-Fura-2 AM

Fluorescent Dyes/Probes

Calcium is an important part of the human body, usually in the form of calcium, a large number of bones and teeth of the human body, a small amount of blood and tissues. MCE calcium ion detection probe can specifically identify intracellular calcium ions, with high sensitivity, low cytotoxicity, increased AM acetylmethyl ester can enter the cell well, after being sheared by the intracellular esterase stay in the cell to bind to calcium ions, produce strong fluorescence, in addition, Mag-indo-1/AM and Mag-Fluo-4 AM at a certain concentration (usually 5 mM) can effectively identify intracellular magnesium ions .

Cat. No.	Product Name	Type

HY-139414

Lysophosphatidylcholines 1 Publications Verification	Biochemical Assay Reagents
Lysophosphatidylcholines is an orally active lysolipid and a component of oxidized low density lipoprotein (LDL). Lysophosphatidylcholines induces cell injury, the production of IL-1β and apoptosis. Lysophosphatidylcholines has a proactive effect on sepsis .

HY-P1956

Human serum albumin

1 Publications Verification

HSA

Native Proteins

Human serum albumin (HSA) is the most abundant protein in plasma and is a major determinant of plasma oncotic pressure. Human serum albumin exhibits antioxidant, anticoagulant, anti-inflammatory, anti-platelet aggregation activities as well as colloid osmotic action. Human serum albumin can block the inhibitory effect of GML on human T cells, providing protective function for T cells. Human serum albumin is also associated with cardiovascular diseases and can partially prevent the LPS (HY-D1056) induced oxidative stress, as well as the upregulation of NF-κB, NF-κB, and peroxynitrite (ONOO ⁻) in the vascular wall, contributing to the reduction of blood pressure .

HY-W010934

3β,5α,6β-Trihydroxycholestane

Biochemical Assay Reagents

3β,5α,6β-Trihydroxycholestane is a steroid that occurs naturally in the body and is also found in certain foods. It belongs to a class of compounds known as cholestanes, which are closely related to the better known cholesterol. This particular compound is formed from cholesterol through a series of enzymatic reactions in the liver and other organs. It has been studied for its potential health benefits, including its ability to reduce inflammation and oxidative stress in the body. Some research suggests that it may also play a role in regulating blood sugar levels and improving insulin sensitivity. Despite these potential benefits, 3β,5α,6β-Trihydroxycholestane is not widely used as a supplement or medicine due to its relatively low content, focus on natural resources and limited research. However, researchers continue to investigate its potential uses and effects on human health.

HY-D1005A22

Poloxamer 338 (F108) PEG-PPG-PEG, 14600 (Averag)	Co-solvents
Poloxamer 338 F108 is block polymer of polyoxyethylene and polyoxypropylene with average molecular mass of 14600. Poloxamer 338 F108 reduces the aggregation of red blood cells, inhibits proliferation of human lymphocyte cell IIBR1. Poloxamer 338 F108 exhibits short-term and subchronic toxicity in rats .

HY-125139

omega-3 Arachidonic acid ethyl ester

ω-3 Arachidonic acid ethyl ester; (all-Z)-8,11,14,17-Eicosatetraenoic acid ethyl ester

Biochemical Assay Reagents

omega-3 Arachidonic Acid ethyl ester is a rare polyunsaturated fatty acid found in very small amounts in dietary sources. Omega-3 fatty acids are known to be essential for the growth and development of infants, and they protect against heart disease, blood clots, high blood pressure, and inflammatory and autoimmune diseases. In human platelet membranes, omega-3 arachidonic acid inhibits arachidonyl-CoA synthetase with a Ki of 14 μM. It also inhibits arachidonoyl-CoA synthetase in calf brain extract with an IC50 of approximately 5 μM. Omega-3 ethyl arachidonate is the more lipophilic form of the free acid.

Cat. No.	Product Name	Target	Research Area

HY-P5645

LEAP-2

human liver expressed antimicrobial peptide-2
Peptides Infection

LEAP-2 is an antimicrobial peptide derived from human blood .

HY-P5722

Peptide 5f	Peptides	Infection
Peptide 5f is an antimicrobial peptide derived from wasp venom. Peptide 5f has antimicrobial activity against bacteria and fungi. Peptide 5f has little hemolytic activity on human red blood cells .

HY-P5058

Cyclolinopeptide B

Peptides Inflammation/Immunology

Cyclolinopeptide B is a cyclic nonapeptide with immunosuppressive activity on human peripheral blood lymphocytes .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-P5792

Atrial natriuretic peptide (3-28) (human) ANP (3-28) (human)	Endothelin Receptor	Metabolic Disease
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .

HY-P2273

Calcitonin (human)	CGRP Receptor	Metabolic Disease
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .

HY-P5581

Alloferon 1	Peptides	Infection Inflammation/Immunology Cancer
Alloferon 1 is an antiviral and antitumoral peptide. Alloferon 1 stimulates natural cytotoxicity of human peripheral blood lymphocytes. Alloferon 1 also induces IFN synthesis, and enhances antiviral and antitumor resistance in mice. Alloferon 1 also shows anti-inflammatory activity in λ-carrageenan-induced paw edema model. Alloferon 1 can be isolated from the blood of the blow fly Calliphora vicina (Diptera) .

HY-P2491

Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled	Fluorescent Dye	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .

HY-106224B

Orexin A (human, rat, mouse) (acetate) 3 Publications Verification Hypocretin-1 (human, rat, mouse) (acetate)	Orexin Receptor (OX Receptor)	Neurological Disease
Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate is also an OX1R agonist that induces the expression of BDNF and TH proteins in SH-SY5Y cells in a time- and dose-dependent manner. Orexin A (human, rat, mouse) acetate can be used in studies of appetite regulation, neurodegenerative diseases and modulation of injurious messaging .

HY-12378

BQ-123 2 Publications Verification	Endothelin Receptor	Cardiovascular Disease
BQ-123 is a potent and selective endothelin A (ETA) receptor antagonist with an IC₅₀ of 7.3 nM and a K_i of 25 nM. BQ-123 inhibits endothelin-1-mediated proliferation of human pulmonary artery smooth muscle cells and lowers blood pressure in different rat models of hypertension .

HY-P1323

[Leu31,Pro34]-Neuropeptide Y (human,rat)	Neuropeptide Y Receptor	Cardiovascular Disease Neurological Disease
[Leu31,Pro34]-Neuropeptide Y(human,rat) is a specific neuropeptide Y Y₁ receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) slao activates Y₄, Y₅. [Leu31,Pro34]-Neuropeptide Y(human,rat) can increase blood pressure in anesthetized rats and increases food intake .

HY-P1323A

[Leu31,Pro34]-Neuropeptide Y(human,rat,mouse) TFA 1 Publications Verification	Neuropeptide Y Receptor	Cardiovascular Disease Neurological Disease
[Leu31,Pro34]-Neuropeptide Y(human,rat) TFA is a specific neuropeptide Y Y₁ receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA slao activates Y₄, Y₅. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA can increase blood pressure in anesthetized rats and increases food intake .

HY-P1036

Compstatin 1 Publications Verification	Complement System	Others
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC₅₀ values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .

HY-P1036A

Compstatin TFA 1 Publications Verification	Complement System	Others
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC₅₀ values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .

HY-13948A

Angiotensin II human acetate Maximum Cited Publications 93 Publications Verification Angiotensin II acetate; Ang II acetate; DRVYIHPF acetate	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) acetate is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human acetate plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human acetate stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human acetate induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human acetate also induces apoptosis. Angiotensin II human acetate induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-P1122

Cyclosporin H 1 Publications Verification	Formyl Peptide Receptor (FPR)	Infection Inflammation/Immunology
Cyclosporin H is a selective and potent inhibitor of FPR-1 (formyl peptide receptor 1). Cyclosporin H, a viral transduction enhancer, increases lentiviral transduction up to 10-fold in human cord blood-derived hematopoietic stem and progenitor cells (HSPCs). Cyclosporin H displays an additive effect when combined with Rapamycin (HY-10219) or Prostaglandin E2 (HY-101952). Cyclosporin H lacks immunosuppressant activity of Cyclosporin A.

HY-P4984

Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78)	Biochemical Assay Reagents	Inflammation/Immunology Cancer
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) is a T cell proliferation activator. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) promotes the in vitro proliferation of human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) can be used in research on inflammatory and immunity, as well as cancer .

HY-13948B

Angiotensin II human TFA Maximum Cited Publications 93 Publications Verification Angiotensin II TFA; Ang II TFA; DRVYIHPF TFA	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human TFA induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human TFA also induces apoptosis. Angiotensin II human TFA induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-13948

Angiotensin II human Maximum Cited Publications 93 Publications Verification Angiotensin II; Ang II; DRVYIHPF	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

Cat. No.	Product Name

HY-K0305

Human CD34+ Cells Negative Selection Kit
MCE Human CD34⁺ Cells Negative Selection Kit is designed for the isolation of CD34⁺ cells from human cord blood mononuclear cells (CBMC) or human peripheral blood mononuclear cells (PBMC).

HY-K0304

Human CD3+ T Cells Negative Selection Kit
MCE Human CD3⁺ T Cells Negative Selection Kit is designed for the isolation of CD3⁺ T cells from human peripheral blood mononuclear cells (PBMC).

Cat. No.	Product Name	Target	Research Area

HY-P99371

Lirentelimab AK002; Anti-Siglec-8 Reference Antibody (lirentelimab)	Apoptosis	Inflammation/Immunology
Lirentelimab (AK002) is a humanized IgG1 monoclonal antibody that targets sialic acid-binding Ig-like lectin 8 (SIGLEC8). Lirentelimab induces cell apoptosis of IL-5-activated eosinophils and inhibits IgE-mediated mast cell activation. Lirentelimab can be used for the research of eosinophilic gastritis and duodenitis .

HY-P99879

Efbemalenograstim alfa Benegrastim; Bineuta; F 627	Inhibitory Antibodies	Inflammation/Immunology
Efbemalenograstim alfa (F 627) is a recombinant fusion protein. Efbemalenograstim alfa is a long acting dimeric granulocyte colony-stimulating factor (G-CSF) that contains two human G-CSF fused to a human immunoglobulin G2 (hIgG2)-Fc fragment with a peptide linker. Efbemalenograstim alfa induces the production of white blood cells .

HY-P9928A

Alirocumab (anti-PCSK9) 1 Publications Verification REGN 727(anti-PCSK9); SAR 236553(anti-PCSK9)	Ser/Thr Protease	Cardiovascular Disease
Alirocumab (anti-PCSK9) is a human monoclonal antibody inhibiting proprotein convertase subtilisin/kexin type 9 (PCSK9). Alirocumab specifically binds PCSK9, a down regulator of liver low-density lipoprotein (LDL)-receptors, thereby increasing the ability of the liver to bind LDL-cholesterol (LDL-C) and reducing levels of LDL-C in blood. Alirocumab can be used for the research of hypercholesterolemia .

HY-P99797

Pabinafusp alfa JR-141	Transferrin Receptor	Neurological Disease
Pabinafusp alfa (JR-141) is a transferrin receptor-targeting antibody consisting of Iduronate 2-sulfatase (HY-P76399) and an anti-human transferrin receptor antibody. Pabinafusp alfa is blood-brain permeable and prevents heparan sulfate (HS) deposition in the central nervous system of mucopolysaccharidosis II (MPS II) mice. Pabinafusp alfa improves learning and prevents central nervous system neuronal damage in mice .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-118870

γ-Globulins from human blood	Natural Products Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields Inflammation/Immunology	Endogenous Metabolite
γ-Globulins from human blood are a class of proteins in the blood. γ-Globulin is a protein fraction of blood serum containing many antibodies that protect against bacterial and viral infectious diseases. γ-Globulins from human blood is used for common variable immunodeficiency

HY-113098

2-Oxovaleric acid	Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
2-Oxovaleric acid is a keto acid that is found in human blood.

HY-107275

Ebeiedinone	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Source classification Plants Fritillaria ussuriensis Maxim.	Cholinesterase (ChE)
Ebeiedinone, a steroidal alkaloid from Fritillaria species, inhibits the bioactivity of human whole blood cholinesterase (ChE) at the concentration of 0.1 mM, with the inhibitory effects of 69.0% .

HY-W050031

(S)-3-Hydroxybutanoic acid 1 Publications Verification (S)-β-Hydroxybutanoic acid; L-(+)-3-Hydroxybutyric acid; L-β-Hydroxybutyric acid	Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
(S)-3-Hydroxybutanoic acid is a normal human metabolite, that has been found elevated in geriatric patients remitting from depression. In humans, 3-Hydroxybutyric acid is synthesized in the liver from acetyl-CoA, and can be used as an energy source by the brain when blood glucose is low.

HY-N11691

Thapsigargicin Thapsigargicine	Structural Classification Terpenoids Source classification Diterpenoids Plants Umbelliferae	Others
Thapsigargicin (Thapsigargicine) is a activator of mast cells and leukocytes. Thapsigargicin induces histamine release from rat peritoneal mast cells and human basophil leukocytes. Thapsigargicin increases the cytoplasmic free calcium level in intact human blood platelets .

HY-N6857

Armepavine	Alkaloids Monophenols other families Classification of Application Fields Source classification Phenols Nelumbo nucifera Gaertn. Plants Isoquinoline Alkaloids Inflammation/Immunology Disease Research Fields Nymphaeaceae	NF-κB
Armepavine, an active compound from Nelumbo nucifera, exerts not only anti-inflammatory effects on human peripheral blood mononuclear cells, but also immunosuppressive effects on T lymphocytes and on lupus nephritic mice. Armepavine inhibits TNF-α-induced MAPK and NF-κB signaling cascades .

HY-112948

2-Methylbutyrylcarnitine	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
2-Methylbutyrylcarnitine is a fatty acid metabolite. 2-Methylbutyrylcarnitine is found mainly in the blood and urine of humans and animals and is produced through the pyruvate carboxylation pathway. 2-Methylbutyrylcarnitine exhibits high level in the plasma of subjects with steatohepatitis (NASH) and can be used as an indicator for the diagnosis of metabolic diseases .

HY-129554

cis-9,10-Epoxystearic acid cis-9,10-Epoxyoctadecanoic acid	Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
cis-9,10-Epoxystearic acid (cis-9,10-Epoxyoctadecanoic acid) is an endogenous constituent in human blood and urine. cis-9,10-Epoxystearic acid (cis-9,10-Epoxyoctadecanoic acid) can be produced from oleic acid by enzymic and non-enzymic epoxidation .

HY-N10534

Lewis X trisaccharide Lewis X	Infection Structural Classification Natural Products Polysaccharides Animals Classification of Application Fields Inflammation/Immunology Disease Research Fields Saccharides Cancer	Parasite
Lewis X trisaccharide (Lewis X, Le ^x) is a potent T_H2 regulator, antagonizes LPS-induced IL-12 immune expression. Lewis X trisaccharide is a human histo-blood group antigen, plays an key role in cell-cell adhesion, and servers as a tumor marker. Lewis X trisaccharide is highly expressed in the outer membrane of the parasite, can be used for the immunology research of schistosomiasis .

HY-13948

Angiotensin II human 90+ Cited Publications Angiotensin II; Ang II; DRVYIHPF	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields Endocrinology Cancer	Angiotensin Receptor Apoptosis
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-106784A

(E)-Ajoene	Structural Classification Natural Products Source classification Allium sativum L. Plants Amaryllidaceae	Others
(E)-Ajoene is a oxygenated ajoene and organosulfur compound, which can be acquired via allicin decomposing. The polysulfides from garlic can be converted by human red blood cells into hydrogen sulfide (H2S) and allyl glutathione. (E)-Ajoene has been proved to show neuroprotective effects against ischemic damage. (E)-Ajoene is orally active to inhibit lipid peroxidation. (E)-Ajoene increases the number of cresyl violet-positive neurons and decreases the number of reactive gliosis in the CA1 region .

HY-W010934

3β,5α,6β-Trihydroxycholestane	Structural Classification Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields Steroids	Biochemical Assay Reagents
3β,5α,6β-Trihydroxycholestane is a steroid that occurs naturally in the body and is also found in certain foods. It belongs to a class of compounds known as cholestanes, which are closely related to the better known cholesterol. This particular compound is formed from cholesterol through a series of enzymatic reactions in the liver and other organs. It has been studied for its potential health benefits, including its ability to reduce inflammation and oxidative stress in the body. Some research suggests that it may also play a role in regulating blood sugar levels and improving insulin sensitivity. Despite these potential benefits, 3β,5α,6β-Trihydroxycholestane is not widely used as a supplement or medicine due to its relatively low content, focus on natural resources and limited research. However, researchers continue to investigate its potential uses and effects on human health.

Species:	Human (19)
Tag:	His (15) SUMO (3) GST (2) Fc (2)
Source:	HEK293 (8) E. coli Cell-free (5) CHO (1) E. coli (5)

Cat. No.	Compare	Product Name	Species	Source

HY-P73926

	*Histo-blood* group ABO/ABO Protein, Human (HEK293, Fc)** Histo-blood group ABO system transferase; ABO; NAGAT	Human	HEK293
	The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is 292 a.a., with molecular weight of ~62-68 kDa.

HY-P70896

	ERMAP Protein, Human (HEK293, His) Erythroid Membrane-Associated Protein; hERMAP; Radin blood Group Antigen; Scianna blood Group Antigen; ERMAP; RD; SC	Human	HEK293
	ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ERMAP Protein, Human (HEK293, His) is 126 a.a., with molecular weight of ~16.0 kDa.

HY-P70324

	KEL/Kelch-like protein 41 Protein, Human (HEK293, His) rHuKell blood group glycoprotein/KEL, His; Kell blood group glycoprotein; CD238; KEL	Human	HEK293
	KEL/Kelch-like protein 41 acts as a zinc endopeptidase with a distinct endothelin-3-converting enzyme function. It selectively cleaves endothelin-1 (EDN1), endothelin-2 (EDN2), and endothelin-3 (EDN3), displaying a preference for EDN3. KEL's endopeptidase activity plays a pivotal role in processing endothelin peptides, emphasizing its involvement in the modulation of endothelin signaling pathways. KEL/Kelch-like protein 41 Protein, Human (HEK293, His) is the recombinant human-derived KEL/Kelch-like protein 41 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of KEL/Kelch-like protein 41 Protein, Human (HEK293, His) is 665 a.a., with molecular weight of 85-120 kDa.

HY-P702423

	RHD Protein, Human (Cell-Free, His) RHD; Rh blood group; Rh blood group D antigen; Rh blood group, D antigen; RhD polypeptide; RhD protein; Rhesus blood group D antigen; Rhesus blood group D antigen variant; Rhesus blood group, D antigen	Human	E. coli Cell-free
	RHD Protein is a member of the ammonium transporter (TC 2.A.49) family, particularly within the Rh subfamily. RHD Protein, Human (Cell-Free, His) is the recombinant human-derived RHD protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of RHD Protein, Human (Cell-Free, His) is 417 a.a., with molecular weight of 51.2 kDa.

HY-P702224

	Blood group RhD polypeptide Protein, Human (Cell-Free, His) blood group Rh(D) polypeptide; RHXIII; Rh polypeptide 2; RhPII; Rhesus D antigen	Human	E. coli Cell-free
	RhD blood group polypeptide proteins emerged as potential components of oligomeric complexes, suggesting that they may be involved in structures within the erythrocyte membrane with potential transport or channel functions. Blood group RhD polypeptide Protein, Human (Cell-Free, His) is the recombinant human-derived Blood group RhD polypeptide protein, expressed by E. coli Cell-free , with C-10*His labeled tag. The total length of Blood group RhD polypeptide Protein, Human (Cell-Free, His) is 416 a.a., with molecular weight of 47.9 kDa.

HY-P70324A

	KEL/Kelch-like protein 41 Protein, Human (HEK293, C-His) rHuKell blood group glycoprotein/KEL, His; Kell blood group glycoprotein; CD238; KEL	Human	HEK293
	KEL/Kelch-like protein 41 acts as a zinc endopeptidase with a distinct endothelin-3-converting enzyme function. It selectively cleaves endothelin-1 (EDN1), endothelin-2 (EDN2), and endothelin-3 (EDN3), displaying a preference for EDN3. KEL's endopeptidase activity plays a pivotal role in processing endothelin peptides, emphasizing its involvement in the modulation of endothelin signaling pathways. KEL/Kelch-like protein 41 Protein, Human (HEK293, C-His) is the recombinant human-derived KEL/Kelch-like protein 41 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of KEL/Kelch-like protein 41 Protein, Human (HEK293, C-His) is 665 a.a., with molecular weight of ~91.71 kDa.

HY-P700380

	ACKR1 Protein, Human (Cell-Free, His) ACKR1; atypical chemokine receptor 1 (Duffy blood group); DARC; Duffy blood group, chemokine receptor; Duffy blood group , FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; FY; GpFy; WBCQ1	Human	E. coli Cell-free
	ACKR3, an atypical chemokine receptor, modulates chemokine levels and localization by high-affinity binding, inducing sequestration, degradation, or transcytosis. Also known as a chemokine interceptor or decoy receptor, ACKR3 binds to chemokines like CXCL11 and CXCL12/SDF1. Unlike conventional signaling, ACKR3 triggers beta-arrestin recruitment, leading to ligand internalization and MAPK pathway activation. In interneurons, it regulates CXCR4 levels, adapting chemokine responsiveness. In glioma cells, it activates the MEK/ERK pathway, influencing growth and survival. While inactive in normal hematopoietic cells, ACKR3, activated by CXCL11 in malignant cells, enhances cell adhesion, migration, and acts as an HIV coreceptor. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of ACKR1 Protein, Human (Cell-Free, His) is 336 a.a., with molecular weight of 41.1 kDa.

HY-P73538

	*XG/Xg blood* group Protein, Human (HEK293, His)** Glycoprotein Xg; Protein PBDX; Xg; XGPY	Human	HEK293
	XG/Xg blood group Protein is a type I transmembrane glycoprotein belonging to the CD99 family. It is a erythrocyte membrane protein that is used as the basis of the Xg blood group system. XG/Xg blood group Protein, Human (HEK293, His) is the recombinant human-derived XG/Xg blood group protein, expressed by HEK293 , with C-His labeled tag. The total length of XG/Xg blood group Protein, Human (HEK293, His) is 122 a.a., with molecular weight of ~14.6 kDa.

HY-P73539

	*XG/Xg blood* group Protein, Human (HEK293, Fc)** Glycoprotein Xg; Protein PBDX; Xg; XGPY	Human	HEK293
	XG/Xg blood group Protein is a type I transmembrane glycoprotein belonging to the CD99 family. It is a erythrocyte membrane protein that is used as the basis of the Xg blood group system. XG/Xg blood group Protein, Human (HEK293, Fc) is the recombinant human-derived XG/Xg blood group protein, expressed by HEK293 , with C-mFc labeled tag. The total length of XG/Xg blood group Protein, Human (HEK293, Fc) is 143 a.a., with molecular weight of ~39.6 kDa.

HY-P79277

	Acetylcholinesterase/ACHE Protein, Human (CHO, His) acetylcholinesterase (Yt blood group); Acetylcholinesterase; ACHE; apoptosis-related acetylcholinesterase; ARACHE; EC 3.1.1; EC 3.1.1.7; N-ACHE; Yt blood group; YT	Human	CHO
	Acetylcholinesterase (ACHE) protein is pivotal in neurotransmission, rapidly hydrolyzing acetylcholine in the synaptic cleft to terminate signal transduction at the neuromuscular junction. Beyond neurotransmitter regulation, ACHE is implicated in neuronal apoptosis, indicating a broader role in cellular processes associated with programmed cell death. Acetylcholinesterase/ACHE Protein, Human (CHO, His) is the recombinant human-derived Acetylcholinesterase/ACHE protein, expressed by CHO , with C-6*His labeled tag. The total length of Acetylcholinesterase/ACHE Protein, Human (CHO, His) is 583 a.a., with molecular weight of ~66 kDa.

HY-P75597

	BVES Protein, Human (GST) blood vessel epicardial substance; hBVES; Popeye protein 1; BVES; POP1; POPDC1	Human	E. coli
	BVES protein is a cell adhesion molecule that is essential for the paracellular permeability barrier of tight junctions in epithelial cells. BVES Protein, Human (GST) is the recombinant human-derived BVES protein, expressed by E. coli , with N-GST labeled tag. The total length of BVES Protein, Human (GST) is 36 a.a., with molecular weight of ~32.2 kDa.

HY-P702422

	RHCE Protein, Human (Cell-Free, His) blood group Rh(CE) polypeptide; Rh polypeptide 1; RhPI; Rh30A; RhIXB; Rhesus C/E antigens	Human	E. coli Cell-free
	The RHCE protein is an important component of the ankyrin-1 complex and is essential for the stability and shape of the red blood cell membrane. RHCE Protein, Human (Cell-Free, His) is the recombinant human-derived RHCE protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of RHCE Protein, Human (Cell-Free, His) is 417 a.a., with molecular weight of 47.1 kDa.

HY-P72085

	AQP1 Protein, Human (His-SUMO) AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_human; aquaporin 1 channel-forming integral protein; 28kDa; CO blood group; ; aquaporin 1 Colton blood group; ; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO; Colton blood group; Growth factor induced delayed early response protein; MGC26324; Urine water channel; Water channel protein CHIP 29; Water channel protein CHIP29; Water channel protein for red blood cells and kidney proximal tubule	Human	E. coli
	The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of AQP1 Protein, Human (His-SUMO) is 50 a.a., with molecular weight of ~21.6 kDa.

HY-P700377

	Aquaporin-1/AQP1 Protein, Human (Cell-Free, His-SUMO) AQP CHIP; AQP-1; AQP1; AQP1_human; aquaporin 1 channel-forming integral protein; 28kDa; CO blood group; ; aquaporin 1 Colton blood group; ; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO; Colton blood group; Growth factor induced delayed early response protein; MGC26324; Urine water channel; Water channel protein CHIP 29; Water channel protein CHIP29; Water channel protein for red blood cells and kidney proximal tubule	Human	E. coli Cell-free
	The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. Aquaporin-1/AQP1 Protein, Human (Cell-Free, His-SUMO) is the recombinant human-derived Aquaporin-1/AQP1 protein, expressed by E. coli Cell-free , with N-SUMO, N-6*His labeled tag. The total length of Aquaporin-1/AQP1 Protein, Human (Cell-Free, His-SUMO) is 268 a.a., with molecular weight of 41.3 kDa.

HY-P72086

	AQP1 Protein, Human (GST) AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_human; aquaporin 1 channel-forming integral protein; 28kDa; CO blood group; ; aquaporin 1 Colton blood group; ; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO;	Human	E. coli
	The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (GST) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-GST labeled tag. The total length of AQP1 Protein, Human (GST) is 50 a.a., with molecular weight of ~31 kDa.

HY-P70029

	Basigin/CD147 Protein, Human (HEK293, His) rHuBasigin/CD147, His ; Basigin; 5F7; Collagenase Stimulatory Factor; Extracellular Matrix Metalloproteinase Inducer; EMMPRIN; Leukocyte Activation Antigen M6; OK blood Group Antigen; Tumor Cell-Derived Collagenase Stimulatory Factor; TCSF; CD147; BSG	Human	HEK293
	Basigin/BSG proteins are critical for retinal maturation and development and function as retinal cell receptors for NXNL1, promoting the survival of retinal cone photoreceptors. Basigin/CD147 Protein, Human (HEK293, His) is the recombinant human-derived Basigin/CD147 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Basigin/CD147 Protein, Human (HEK293, His) is 184 a.a., with molecular weight of 30-40 kDa.

HY-P72014

	CLEC4C Protein, Human (His-SUMO) CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303	Human	E. coli
	CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (His-SUMO) is the recombinant human-derived CLEC4C protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of CLEC4C Protein, Human (His-SUMO) is 169 a.a., with molecular weight of ~36.0 kDa.

HY-P71145

	PRDX6 Protein, Human (His) Peroxiredoxin-6; 1-Cys Peroxiredoxin; 1-Cys PRX; 24 kDa Protein; Acidic Calcium-Independent Phospholipase A2; aiPLA2; Antioxidant Protein 2; Liver 2D PAGE Spot 40; Non-Selenium Glutathione Peroxidase; NSGPx; Red blood Cells Page Spot 12; PRDX6; AOP2; KIAA0106	Human	E. coli
	The PRDX6 protein is a thiol-specific peroxidase that plays a crucial role in cellular defense against oxidative stress. It catalyzes the reduction of hydrogen peroxide and various organic hydroperoxides to water and alcohols. PRDX6 Protein, Human (His) is the recombinant human-derived PRDX6 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PRDX6 Protein, Human (His) is 224 a.a., with molecular weight of 30-33 kDa.

HY-P71679

	CLEC4C Protein, Human (HEK293, His) CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303	Human	HEK293
	CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (HEK293, His) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC4C Protein, Human (HEK293, His) is 169 a.a., with molecular weight of ~24.0 kDa.

Cat. No.	Product Name	Chemical Structure

HY-B0227S1

Ketoprofen-d4
Ketoprofen-d₄ is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-B0227S

Ketoprofen-d3
Ketoprofen-d₃ is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-15321S

Etoricoxib-d4 1 Publications Verification
Etoricoxib-d₄ is a deuterium labeled Etoricoxib. Etoricoxib is a non steroidal anti-inflammatory agent, acting as a selective and orally active COX-2 inhibitor, with IC50s of 1.1 μM and 116 μM for COX-2 and COX-1 in human whole blood.

HY-15321S2

Etoricoxib-d3
Etoricoxib-d₃ is the deuterium labeled Etoricoxib[1]. Etoricoxib (MK-0663) is a non steroidal anti-inflammatory agent, acting as a selective and orally active COX-2 inhibitor, with IC50s of 1.1 μM and 116 μM for COX-2 and COX-1 in human whole blood[2][3][4].

HY-B0589S1

Atorvastatin-d5 sodium
Atorvastatin-d₅ (sodium) is the deuterium labeled Atorvastatin sodium. Atorvastatin sodium is an orally active HMG-CoA reductase inhibitor, has the ability to effectively decrease blood lipids. Atorvastatin sodium inhibits human SV-SMC proliferation and invasion with IC50s of 0.39 μM and 2.39 μM, respectively[1][2][3][4].

HY-B0227S2

Ketoprofen-13C,d3
Ketoprofen- ¹³C,d₃ is the ¹³C- and deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-B0589S

Atorvastatin-d5 hemicalcium
Atorvastatin-d₅ (hemicalcium) is the deuterium labeled Atorvastatin. Atorvastatin hemicalcium is an orally active HMG-CoA reductase inhibitor, has the ability to effectively decrease blood lipids. Atorvastatin hemicalcium inhibits human SV-SMC proliferation and invasion with IC50s of 0.39 μM and 2.39 μM, respectively[1][2][3].

HY-14397S

Indomethacin-d4
Indomethacin-d₄ is a deuterium labeled Indomethacin. Indomethacin is a potent, blood-brain permeable and nonselective inhibitor of COX1 and COX2, with IC50s of 18 nM and 26 nM for human COX-1 and COX-2, respectively, in CHO cells[1]. Indomethacin disrupts autophagic flux by disturbing the normal functioning of lysosomes[2].

HY-14397S1

Indomethacin-d4 Methyl Ester
Indomethacin-d₄ Methyl Ester is the deuterium labeled Indomethacin. Indomethacin (Indometacin) is a potent, blood-brain permeable and nonselective inhibitor of COX1 and COX2, with IC50s of 18 nM and 26 nM for human COX-1 and COX-2, respectively, in CHO cells[1]. Indomethacin disrupts autophagic flux by disturbing the normal functioning of lysosomes[2].

HY-15321S1

Etoricoxib-13C,d3
Etoricoxib- ¹³C,d₃ is the ¹³C- and deuterium labeled Etoricoxib. Etoricoxib (MK-0663) is a non steroidal anti-inflammatory agent, acting as a selective and orally active COX-2 inhibitor, with IC50s of 1.1 μM and 116 μM for COX-2 and COX-1 in human whole blood.

HY-13948BS

Angiotensin II human-13C6,15N TFA

Angiotensin II human- ¹³C₆, ¹⁵N TFA (Ang II- ¹³C₆, ¹⁵N TFA) is ¹³C- and ¹⁵N-labeled Angiotensin II human (TFA) (HY-13948B). Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions .

HY-A0168S

Regadenoson-d3

Regadenoson-d₃ is the deuterium labeled Regadenoson. Regadenoson (CVT-3146) is a potent and selective A2A adenosine receptor agonist, with Kis of 290 and 1120 nM for rat and pig adenosine A2A receptor, respectively. Regadenoson is selective for the adenosine A2A receptor over adenosine A1 and A2B receptors, and shows 13-fold selectivity over the human adenosine A1 receptor. Regadenoson is a vasodilator stress agent has shifted the landscape of vasodilator myocardial perfusion imaging. Regadenoson increases blood-brain barrier (BBB) permeability in rodents[1][2][3].

Cat. No.	Product Name	Application	Reactivity

HY-P83643

Phospho-PKM2(Tyr148)Antibody PKM2 (Phospho Tyr148); PKM2 (Phospho Y148); PK 1; PK 2; PK 3; PK Muscle type; PK1; PK2; Pk3; PKL; PKLR; PKM 2; PKM; PYKM; Pyruvate kinase 1; Pyruvate kinase 2/3; Pyruvate kinase 3; Pyruvate kinase isozyme R/L; Pyruvate kinase isozymes M1/M2; Pyruvate kinase liver and blood cell; Pyruvate kinase liver and RBC; Pyruvate kinase liver and RBC type; Pyruvate kinase M2; Pyruvate kinase muscle; Pyruvate kinase muscle isozyme; Pyruvate kinase type L; R type/L type pyruvate kinase; Red cell/liver pyruvate kinase; RPK; TCB; THBP 1; THBP1; Thyroid hormone binding protein cytosolic; CTHBP; Cytosolic thyroid hormone binding protein; MGC3932; OIP 3; Oip3; Tumor M2-PK; p58; OIP-3; KPYM_human.	WB, IHC-P, IHC-F, ICC, IF, Flow-Cyt, ELISA	Human (predicted: Mouse, Rat, Pig, Cow, Rabbit, Sheep, GuineaPig)

Cat. No.	Product Name		Classification

HY-106850

3′-Azido-2′,3′-dideoxyuridine AzdU; AzddU; CS-87		Azide
3′-Azido-2′,3′-dideoxyuridine (AzdU) is a nucleoside analog of Zidovudine (HY-17413). 3′-Azido-2′,3′-dideoxyuridine is a potent inhibitor of human immunodeficiency virus (HIV) replication in human peripheral blood mononuclear cells (PBMC) with limited toxicity for human bone marrow cells (BMC) . 3′-Azido-2′,3′-dideoxyuridine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

MCE Kits

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Click Chemistry

human blood

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

MCE Kits

Inhibitory Antibodies

NaturalProducts

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Click Chemistry

Natural
Products